• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Longest Duration Videos - Page 567

  • All Time
  • Today
  • Last 7 days
  • Last 30 days
Back entrance opens on a truck and also delivers motorcyclist to the und 100% 00:12
Back entrance opens on a truck and also delivers motorcyclist to the und
Dual assassins take laborer out 0% 00:12
Dual assassins take laborer out
Fat female lands like a bag of spunk 100% 00:12
Fat female lands like a bag of spunk
Last air travel as a result of to disastrous rotten luck 100% 00:12
Last air travel as a result of to disastrous rotten luck
Los angeles many criminals decrease catalytic converters off 0% 00:12
Los angeles many criminals decrease catalytic converters off
Cops police officer shows significance of weapon safety and security 100% 00:12
Cops police officer shows significance of weapon safety and security
Ru dumbbells killed a disarmed ua pow after he stated 0% 00:12
Ru dumbbells killed a disarmed ua pow after he stated
Soldiers intercepted through projectile 100% 00:12
Soldiers intercepted through projectile
A few of the 9 gotten rid of in a mass murder in honduras (better quali 0% 00:12
A few of the 9 gotten rid of in a mass murder in honduras (better quali
A few of the 9 gotten rid of in a carnage in honduras (far better quali 0% 00:12
A few of the 9 gotten rid of in a carnage in honduras (far better quali
Sweet desires mama fucker! 0% 00:12
Sweet desires mama fucker!
Man runs into road to die 100% 00:12
Man runs into road to die
Man tries to break into occupied home 100% 00:12
Man tries to break into occupied home
Man falls on another man holding a hat 0% 00:12
Man falls on another man holding a hat
The khokhlys try an unarmed surrendered russian uncensore 0% 00:12
The khokhlys try an unarmed surrendered russian uncensore
Last dive ends in tragedy for loved ones 0% 00:12
Last dive ends in tragedy for loved ones
Three-way massacre in mexico uncensored videos murders, execut 0% 00:12
Three-way massacre in mexico uncensored videos murders, execut
Waiting for the right minute 100% 00:12
Waiting for the right minute
When a car engages in bowling on the road 0% 00:12
When a car engages in bowling on the road
2 canadian turists fire at mexican resort 0% 00:12
2 canadian turists fire at mexican resort
Prev557558559560561562563564565566567568569570571572573574575576577Next

Popular Tags

accidentincidentbloodwtffatalmurdersyriadeadgorecrashviolentdeathroadkillviolenceinjurycrimewarattackcarvehicletrafficcollisionbombingrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.