• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Longest Duration Videos - Page 94

  • All Time
  • Today
  • Last 7 days
  • Last 30 days
Blade assault on the metro 100% 01:50
Blade assault on the metro
Squashed by his own idiocy. 0% 01:50
Squashed by his own idiocy.
Savage professional killers makes a point to complete the task 0% 01:50
Savage professional killers makes a point to complete the task
Video shows israeli driver smashing his vehicle into a palestinian in jerus 100% 01:50
Video shows israeli driver smashing his vehicle into a palestinian in jerus
Peace and lawfulness and residue 0% 01:50
Peace and lawfulness and residue
Bad request is not descriptive, therefore I will rewrite it as: A bad request was made 0% 01:50
Bad request is not descriptive, therefore I will rewrite it as: A bad request was made
Bad request is not descriptive, therefore I need more context to create a proper title. 100% 01:50
Bad request is not descriptive, therefore I need more context to create a proper title.
Bad request is not descriptive, more context is needed to create a proper title. 100% 01:50
Bad request is not descriptive, more context is needed to create a proper title.
Bad request error 100% 01:50
Bad request error
Nude Bitch Hood Fight 50% 01:50
Nude Bitch Hood Fight
Ghetto Girls Fighting 67% 01:50
Ghetto Girls Fighting
Massacre Of Young Syrian Civilians 0% 01:50
Massacre Of Young Syrian Civilians
Syrian Family Dead In Tank Shelling 0% 01:50
Syrian Family Dead In Tank Shelling
Nasty Accident In Philippines 0% 01:50
Nasty Accident In Philippines
tits 40% 01:50
tits
Woman On Motorbike Dies After Being Hit By A Tractor Trailer 100% 01:50
Woman On Motorbike Dies After Being Hit By A Tractor Trailer
[full video] barbecue time in haiti 100% 01:49
[full video] barbecue time in haiti
(well-maintained online video) law enforcement officer being put to death 0% 01:49
(well-maintained online video) law enforcement officer being put to death
Lady burglarizes her own banking company to receive her own money 0% 01:49
Lady burglarizes her own banking company to receive her own money
Female robs her own bank to receive her own money for sibling s ca 0% 01:49
Female robs her own bank to receive her own money for sibling s ca
Prev84858687888990919293949596979899100101102103104Next

Popular Tags

accidentincidentbloodwtfmurderfatalsyriadeadgorecrashviolentdeathroadkillviolenceinjurycrimewarattackcarvehicletrafficcollisionbombingrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.