• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Most recent content, these horrible and extreme media files have just been added watch and enjoy! - Page 300

  • Newest
  • Most Viewed
  • Top Rated
  • All Time
  • Today
  • Last 7 days
  • Last 30 days
Two men fatally shot 0% 00:12
Two men fatally shot
Man murder headshot(extra video) 100% 00:38
Man murder headshot(extra video)
Man murder headshot 0% 00:22
Man murder headshot
Man miraculously alive 0% 00:22
Man miraculously alive
Peace and lawfulness and residue 0% 01:50
Peace and lawfulness and residue
Vagrant squashed by transport 0% 02:17
Vagrant squashed by transport
Man toasted in the electric post 100% 00:45
Man toasted in the electric post
Execution of two opponent dealers in brazil 0% 00:14
Execution of two opponent dealers in brazil
Mishap tram mexico city 0% 01:27
Mishap tram mexico city
Wrong spot to loot ! (two points) 100% 01:00
Wrong spot to loot ! (two points)
Biker squashed in the wake of speeding vehicle lets completely go 100% 00:28
Biker squashed in the wake of speeding vehicle lets completely go
Three men met with a hail of projectiles 0% 00:12
Three men met with a hail of projectiles
Swarm looks as canine assaults older man in china 0% 00:28
Swarm looks as canine assaults older man in china
The youngster kicks the bucket while attempting to cross the train track 0% 00:41
The youngster kicks the bucket while attempting to cross the train track
Plane takes off in China 0% 00:09
Plane takes off in China
Man being stoned in the head 100% 00:30
Man being stoned in the head
Cheat compelled to eat crude chicken by irate crowd 0% 02:20
Cheat compelled to eat crude chicken by irate crowd
Cops fire man with firearm 0% 01:18
Cops fire man with firearm
Ideal opportunity to go across the street 0% 00:34
Ideal opportunity to go across the street
Kid who tumbled from a stage onto rail tracks protected (diverse point). 100% 00:29
Kid who tumbled from a stage onto rail tracks protected (diverse point).
Prev290291292293294295296297298299300301302303304305306307308309310Next

Popular Tags

accidentincidentbloodwtfmurderfatalsyriadeadgorecrashviolentdeathkillroadviolenceinjurycrimewarattackcarvehicletrafficbombingcollisionrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.