• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Most popular Content on Horriblevideos.com - Page 385

  • Newest
  • Most Viewed
  • Top Rated
  • All Time
  • Today
  • Last 7 days
  • Last 30 days
Lady perishes sprawled 0% 00:37
Lady perishes sprawled
An eyewitness brought a lost leg to a motorcyclist uncenso 0% 00:18
An eyewitness brought a lost leg to a motorcyclist uncenso
Lady & her kids sent into orbit 100% 00:35
Lady & her kids sent into orbit
Bad request is not descriptive, therefore I will assume it is about a bad or invalid request, however without more context it is impossible to create a proper title. 0% 00:18
Bad request is not descriptive, therefore I will assume it is about a bad or invalid request, however without more context it is impossible to create a proper title.
Dominican man leg brutally hacked with machete 100% 01:41
Dominican man leg brutally hacked with machete
Male discovers what a saber believes that 0% 00:38
Male discovers what a saber believes that
Sicarios fire in the pub killing one 0% 01:54
Sicarios fire in the pub killing one
Motorcyclist killed and traveler with numerous pelvic breaks. 0% 00:15
Motorcyclist killed and traveler with numerous pelvic breaks.
Memorable training for a crook 0% 01:09
Memorable training for a crook
Motoboy go at aspect blank variation 0% 00:40
Motoboy go at aspect blank variation
Vehicle hit by bomb blast 100% 04:35
Vehicle hit by bomb blast
Employee monitoring on a maker ends up getting dragged by it t. 0% 00:26
Employee monitoring on a maker ends up getting dragged by it t.
Peace and lawfulness and residue 0% 01:50
Peace and lawfulness and residue
Old lady crushed by truck 100% 00:16
Old lady crushed by truck
Girl Brawl – 35 100% 01:57
Girl Brawl – 35
Strange Creature 100% 01:15
Strange Creature
Suicidal Guy Takes A Ride 0% 01:21
Suicidal Guy Takes A Ride
Sailor crashed in between 2 ships fell under the sea and disap 0% 01:15
Sailor crashed in between 2 ships fell under the sea and disap
Stitching Deep Face Wound (No Sound) 0% 01:56
Stitching Deep Face Wound (No Sound)
Brutal Assassination Of Civilians 100% 01:12
Brutal Assassination Of Civilians
Prev375376377378379380381382383384385386387388389390391392393394395Next

Popular Tags

accidentincidentbloodwtffatalmurdersyriadeadgorecrashviolentdeathroadkillviolenceinjurycrimewarattackcarvehicletrafficcollisionbombingrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.