• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Best Rated Horrible Clips on Horriblevideos.com - Page 428

  • Newest
  • Most Viewed
  • Top Rated
  • All Time
  • Today
  • Last 7 days
  • Last 30 days
Mishap of motorcyclist 0% 00:48
Mishap of motorcyclist
Fatal Injuries 0% 01:15
Fatal Injuries
Foe murdered by rocket 0% 00:36
Foe murdered by rocket
Butcher gunned down in cold blood stream in colombia 0% 01:01
Butcher gunned down in cold blood stream in colombia
Another idiot gets himself electrocuted s. 0% 01:23
Another idiot gets himself electrocuted s.
Man Suffers From Severe Head Injury 0% 00:23
Man Suffers From Severe Head Injury
Trophy Goes To Fat DJ Dude 0% 01:37
Trophy Goes To Fat DJ Dude
African a super hero satisfies a biased automobile - video clips - vidmax com 0% 00:12
African a super hero satisfies a biased automobile - video clips - vidmax com
The seriously mutilated body of a motorcyclist d. 0% 00:16
The seriously mutilated body of a motorcyclist d.
Man severely injures himself 0% 01:39
Man severely injures himself
Sicarios fire in the pub killing one 0% 01:54
Sicarios fire in the pub killing one
An eyewitness brought a lost leg to a motorcyclist uncenso 0% 00:18
An eyewitness brought a lost leg to a motorcyclist uncenso
Lady perishes sprawled 0% 00:37
Lady perishes sprawled
Stitching Deep Face Wound (No Sound) 0% 01:56
Stitching Deep Face Wound (No Sound)
Dead In Bombardment – 10 0% 01:09
Dead In Bombardment – 10
Peace and lawfulness and residue 0% 01:50
Peace and lawfulness and residue
Motorcyclist killed and traveler with numerous pelvic breaks. 0% 00:15
Motorcyclist killed and traveler with numerous pelvic breaks.
A pair of cops shot inside a watch cars and truck ecuador uncenso 0% 00:13
A pair of cops shot inside a watch cars and truck ecuador uncenso
Bad request is not descriptive, therefore I will assume it is about a bad or invalid request, however without more context it is impossible to create a proper title. 0% 00:18
Bad request is not descriptive, therefore I will assume it is about a bad or invalid request, however without more context it is impossible to create a proper title.
Motoboy go at aspect blank variation 0% 00:40
Motoboy go at aspect blank variation
Prev418419420421422423424425426427428429430431432433434435436437438Next

Popular Tags

accidentincidentbloodwtfmurderfatalsyriadeadgorecrashviolentdeathroadkillviolenceinjurycrimewarattackcarvehicletrafficcollisionbombingrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.