• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Best Rated Horrible Clips on Horriblevideos.com - Page 439

  • Newest
  • Most Viewed
  • Top Rated
  • All Time
  • Today
  • Last 7 days
  • Last 30 days
Old competition ends in savage homicide in the favela 0% 01:46
Old competition ends in savage homicide in the favela
Guy caught swiping beaten as well as chance mexico uncensored vid 0% 00:41
Guy caught swiping beaten as well as chance mexico uncensored vid
Los angeles many criminals decrease catalytic converters off 0% 00:12
Los angeles many criminals decrease catalytic converters off
The leopard takes the pet dog india s murder 0% 01:57
The leopard takes the pet dog india s murder
Bad request is not descriptive, therefore I will assume it's a generic term for a shocking or gory incident, however without more context I can only provide a title that reflects the lack of information: 'Unknown Incident Occurs' 0% 00:25
Bad request is not descriptive, therefore I will assume it's a generic term for a shocking or gory incident, however without more context I can only provide a title that reflects the lack of information: 'Unknown Incident Occurs'
Death endeavor misfires 0% 00:45
Death endeavor misfires
Endeavored outfitted burglary 0% 01:07
Endeavored outfitted burglary
Area laborer mowed down by drunk motorist 0% 01:26
Area laborer mowed down by drunk motorist
Liberal puts best foot forward. 0% 00:21
Liberal puts best foot forward.
Ua soldier gets his arm blown off from a grenade visited 0% 00:22
Ua soldier gets his arm blown off from a grenade visited
Man is hit with sticks 0% 00:30
Man is hit with sticks
Claimed revolutionaries gotten rid of and also gotten rid of 0% 00:35
Claimed revolutionaries gotten rid of and also gotten rid of
Getting leveled by trailer truck 0% 01:02
Getting leveled by trailer truck
The barrnsley team 0% 01:14
The barrnsley team
Woman stabbed by jealous lady 0% 00:24
Woman stabbed by jealous lady
Bad request error occurs 0% 00:45
Bad request error occurs
Bad request is not descriptive, therefore I will rephrase to: A bad request was made 0% 00:40
Bad request is not descriptive, therefore I will rephrase to: A bad request was made
Man is killed 0% 00:17
Man is killed
Motorcyclist dropped an upper arm when traveling mu 0% 01:11
Motorcyclist dropped an upper arm when traveling mu
Coming from the dancing floor to a casket 0% 00:38
Coming from the dancing floor to a casket
Prev429430431432433434435436437438439440441442443444445446447448449Next

Popular Tags

accidentincidentbloodwtfmurderfatalsyriadeadgorecrashviolentdeathroadkillviolenceinjurycrimewarattackcarvehicletrafficcollisionbombingrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.