• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Search results for: angeles

  • Newest
  • Top Rated
  • Most Viewed
Another normal dystopian lost angeles weekend with sideshow 0% 00:56
Another normal dystopian lost angeles weekend with sideshow
Bellflower male try, killed by los angeles deputies after billing at 100% 02:47
Bellflower male try, killed by los angeles deputies after billing at
Disturbing cartel vengeance collection - los angeles t a del gore they 100% 05:28
Disturbing cartel vengeance collection - los angeles t a del gore they
Los angeles cruz de huanacaxtle a female with a hammer attacked a riv 0% 02:11
Los angeles cruz de huanacaxtle a female with a hammer attacked a riv
Los angeles deputies shoot guy as he charges toward 0% 02:53
Los angeles deputies shoot guy as he charges toward
Los angeles deputies shoot guy as he demands toward them with a sword 0% 02:53
Los angeles deputies shoot guy as he demands toward them with a sword
Los angeles many criminals decrease catalytic converters off 0% 00:12
Los angeles many criminals decrease catalytic converters off
Man plunged on a los angeles learn for rapping out loud and also bothersome 100% 01:44
Man plunged on a los angeles learn for rapping out loud and also bothersome

Popular Tags

accidentincidentbloodwtfmurderfatalsyriadeadgorecrashviolentdeathkillroadviolenceinjurycrimewarattackcarvehicletrafficbombingcollisionrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.