• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Search results for: criminals

  • Newest
  • Top Rated
  • Most Viewed
(repost) two killed crooks in funeral home 0% 01:00
(repost) two killed crooks in funeral home
3 criminals rob a bistro yet on their trip the slowest 100% 02:17
3 criminals rob a bistro yet on their trip the slowest
A number of criminals pass away when driving mauled by a mob uncens 0% 00:58
A number of criminals pass away when driving mauled by a mob uncens
Aftermath Of Police Encounter In Pakistan 100% 01:17
Aftermath Of Police Encounter In Pakistan
Assad Army Men Beating Poor Village Couple 67% 03:31
Assad Army Men Beating Poor Village Couple
Belfast lawbreakers set cop ablaze 100% 01:03
Belfast lawbreakers set cop ablaze
Criminals beaten and stoned to Death in Africa 33% 01:07
Criminals beaten and stoned to Death in Africa
Criminals bite the dust attempting to take a vehicle 0% 01:00
Criminals bite the dust attempting to take a vehicle
Criminals crash and quit 0% 01:09
Criminals crash and quit
Criminals murder a resident to take a tycoon amount of cash. 100% 00:22
Criminals murder a resident to take a tycoon amount of cash.
Criminals satisfies big league aura 100% 01:04
Criminals satisfies big league aura
Criminals shoot seller in leg when he endeavors to stand up to 0% 00:45
Criminals shoot seller in leg when he endeavors to stand up to
Criminals with hands cut off 100% 01:08
Criminals with hands cut off
Dead Man With Eyes Gouged 100% 00:40
Dead Man With Eyes Gouged
Execution 100% 02:17
Execution
Five youths criminals were set on fire 33% 01:04
Five youths criminals were set on fire
Lol: simpleton fire playing criminals set themselves ablaze 100% 00:39
Lol: simpleton fire playing criminals set themselves ablaze
Los angeles many criminals decrease catalytic converters off 0% 00:12
Los angeles many criminals decrease catalytic converters off
Lynch Mob In Liberia 0% 01:35
Lynch Mob In Liberia
Mexico: cartel causes criminals to endure 100% 00:27
Mexico: cartel causes criminals to endure
12Next

Popular Tags

accidentincidentbloodwtffatalmurdersyriadeadgorecrashviolentdeathroadkillviolenceinjurycrimewarattackcarvehicletrafficcollisionbombingrequestshotwounderrorbrutalvideo
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.