• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Search results for: decrease

  • Newest
  • Top Rated
  • Most Viewed
The unfavorable guy is actually decrease alive in the belly and also his inte 100% 00:26
The unfavorable guy is actually decrease alive in the belly and also his inte
A man's head is actually gradually decrease off with a small axe uncensored 100% 01:32
A man's head is actually gradually decrease off with a small axe uncensored
Sanfran-shits-co the decrease of america's a lot of expensive cit 0% 00:30
Sanfran-shits-co the decrease of america's a lot of expensive cit
A female wheezing horribly along with her neck decrease uncensored v. 0% 00:40
A female wheezing horribly along with her neck decrease uncensored v.
Male decrease off 4 fingers for robbing m. 0% 00:34
Male decrease off 4 fingers for robbing m.
A residing man is actually decrease coming from the throat to the waist 0% 01:36
A residing man is actually decrease coming from the throat to the waist
Police decrease through traincutions, 0% 00:34
Police decrease through traincutions,
A man is actually beaten along with a machete, his hand is actually decrease off, after that he 100% 01:03
A man is actually beaten along with a machete, his hand is actually decrease off, after that he
The learn decrease the guy in fifty percent uncensored video clips murders, 100% 00:19
The learn decrease the guy in fifty percent uncensored video clips murders,
A man possessed his throat decrease in a pre-prepared grave for him u. 100% 02:04
A man possessed his throat decrease in a pre-prepared grave for him u.
Los angeles many criminals decrease catalytic converters off 0% 00:12
Los angeles many criminals decrease catalytic converters off
Old male decrease brick on bus driver s scalp 0% 00:15
Old male decrease brick on bus driver s scalp

Popular Tags

accidentincidentbloodwtfmurderfatalsyriadeadgorecrashviolentdeathkillroadviolenceinjurycrimewarattackcarvehicletrafficbombingcollisionrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.