• Horrible Videos
  • My Account
  • Login
  • Navigation
  • Home
  • Videos
  • Tags
  • Top Rated
  • Most Viewed
  • Blog

Search results for: order

  • Newest
  • Top Rated
  • Most Viewed
Executed Soldiers Who Refused To Attack Civilians 100% 01:25
Executed Soldiers Who Refused To Attack Civilians
The male neglected the order of the policeman to rest on th 100% 01:49
The male neglected the order of the policeman to rest on th
Fresh Sausages Coming Up!! 67% 01:18
Fresh Sausages Coming Up!!
Live murder of ATM machine Guard 31% 01:04
Live murder of ATM machine Guard
Civilian Brutally Burned And Wounded In The Head 0% 01:00
Civilian Brutally Burned And Wounded In The Head
Demonstrators Shot And Killed By Libyan Army 0% 02:02
Demonstrators Shot And Killed By Libyan Army
Executive carrier worried about order damage 0% 00:50
Executive carrier worried about order damage
Peace and lawfulness and residue 0% 01:50
Peace and lawfulness and residue
The guy took many bullets for disregarding an order to go down t. 0% 00:26
The guy took many bullets for disregarding an order to go down t.
Undertakers Crash Funeral And Seize Corpse from Coffin 0% 00:31
Undertakers Crash Funeral And Seize Corpse from Coffin

Popular Tags

accidentincidentbloodwtfmurderfatalsyriadeadgorecrashviolentdeathkillroadviolenceinjurycrimewarattackcarvehicletrafficcollisionbombingrequestshotwounderrorbrutalbad
  • Videos
  • Most Viewed
  • Top Rated
  • Tags
  • Blog
  • DMCA Notice
  • Terms of Use
  • Privacy Policy
  • Cookie Policy
  • Contact

HorribleVideos.com is the internet's largest collection of shocking, bizarre, and disturbing videos. From brutal car accidents and street fights to industrial accidents and nature's fury - we document the dark side of reality that mainstream media won't show you. All content is user-submitted and reviewed for compliance.

Browse our massive library of most viewed shocking videos, discover top rated disturbing content, or explore our video tags to find exactly what you're looking for.

Copyright © 2026 Horrible Videos - Gore And Painful Tube All Rights Reserved.

Welcome — 18+ Content

This website contains adult material and uses cookies to improve your experience.

By clicking “I’m 18+ & Accept”, you confirm you are over 18 years old and consent to our use of cookies.